OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels

Amir Jalali, Frank Bosmans, Mehriar Amininasab, Elke Clynen, Eva Cuypers, Abbas Zaremirakabadi, Mohammad Nabi Sarbolouki, Liliane Schoofs, Hossein Vatanpour, Jan Tytgat

Research output: Contribution to journalArticlepeer-review

Abstract

In this study, we isolated and pharmacologically characterized the first α-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR. Using the two-electrode voltage clamp technique, the pharmacological effects of OD1 were studied on three cloned voltage-gated Na+ channels expressed in Xenopus laevis oocytes (Nav1.2/β1, Na v1.5/β1, para/tipE). The inactivation process of the insect channel, para/tipE, was severely hampered by 200 nM of OD1 (EC 50 = 80 ± 14 nM) while Nav1.2/β1 still was not affected at concentrations up to 5 μM. Nav1.5/ β1 was influenced at micromolar concentrations.

Original languageEnglish (US)
Pages (from-to)4181-4186
Number of pages6
JournalFEBS Letters
Volume579
Issue number19
DOIs
StatePublished - Aug 1 2005

Keywords

  • Iranian scorpion Odonthobuthus doriae
  • Voltage-gated Na channel
  • α-like toxin

ASJC Scopus subject areas

  • Biophysics
  • Structural Biology
  • Biochemistry
  • Molecular Biology
  • Genetics
  • Cell Biology

Fingerprint Dive into the research topics of 'OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na<sup>+</sup> channels'. Together they form a unique fingerprint.

Cite this